Davidensigniatennisacademy.wansport.com is a subdomain of Wansport.com, which was created on 2010-03-22,making it 14 years ago.
Description:Sistema di prenotazione online campi...
Keywords:prenotazione online, prenotazione tennis, prenotazione calcio, tennis, sport, prenotazione...
Discover davidensigniatennisacademy.wansport.com website stats, rating, details and status online.Use our online tools to find owner and admin contact info. Find out where is server located.Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Go to regular site
HomePage size: 23.272 KB |
Page Load Time: 0.936553 Seconds |
Website IP Address: 168.119.56.30 |
Tennis Plaza Store Locations - Tennis Plaza Stores stores.tennisplaza.com |
Play Tennis & Learn the Game | Find a Tennis Tournament | USTA oklahoma.usta.com |
Stan Oley - Pro Tennis - Stan Oley's Tennis Inc. - Viera FL stanoley.usptapro.com |
Official Site of Men's Professional Tennis | ATP Tour | Tennis credential.atpworldtour.com |
East Valley Seniors Tennis League at Tencap Tennis | East Valley Seniors Tennis League evstl.tencapsports.com |
Tencap Tennis Tencap Tennis northampton.tencaptennis.com |
WTA Scores, WTA Results, Tennis News, Tennis Links: Quick Sports tennis.quickfound.net |
Online Tennis Instruction Home - Online Tennis Instruction - Learn How To Play Your Best Tennis, Fre plc.onlinetennisinstruction.com |
Oxnard Home - Agape Tennis Academy at Oxnard Tennis Center oxnard.agapetennisacademy.com |
date: Wed, 15 May 2024 05:53:35 GMT |
server: Apache |
p3p: CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM" |
expires: Wed, 17 Aug 2005 00:00:00 GMT |
cache-control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 |
pragma: no-cache |
set-cookie: 9e5346ac054519bcea95f5a96465df3f=84k5277r1lvk1ogl2fi4bgis2q; path=/; secure; HttpOnly, HASID=eus105; path=/ |
x-content-type-options: nosniff |
last-modified: Wed, 15 May 2024 05:53:35 GMT |
vary: Accept-Encoding,User-Agent |
transfer-encoding: chunked |
content-type: text/html; |
content="IE=edge,chrome=1" http-equiv="x-ua-compatible"/ |
content="width=device-width, initial-scale=1.0, user-scalable=no, minimum-scale=1.0, maximum-scale=1.0" name="viewport"/ |
content="Are you a web developer? Drop your CV here: info@enterpriseds.it" name="X-Recruiting"/ |
content="https://cdn-eu.wansport.com/davidensigniatennisacademy.wansport.com/aafe369c17e1/azienda/thumb/364e05f98271fc8ea9fbb291db7c748062f0e79c.png" property="og:image"/ |
content="David Ensignia Tennis Academy" property="og:site_name"/ |
content="app-id=6445919117, affiliate-data=" name="apple-itunes-app"/ |
content="text/html; charset=utf-8" http-equiv="content-type" |
content="prenotazione online, prenotazione tennis, prenotazione calcio, tennis, sport, prenotazione web, sistema prenotazione, wansport.com, wansport, wansport tennis, wansport calcio, prenota campo" name="keywords" |
content="Sistema di prenotazione online campi da Tennis" name="description" |
content="Wansport WS7" |
Ip Country: Germany |
City Name: Gladbeck |
Latitude: 51.5603 |
Longitude: 7.0063 |
management system Access Register Programs and Enrollments Access Register Programs and Enrollments davidensigniatennis@gmail.com +1 (305)833-3896 3058333896 David Ensignia Tennis Academy Users access Stay connected Forgot the password? Not registered? Register Password reset × Enter email or mobile you used for the registration Enter verification code we have sent via email and SMS 12425 Sunset Dr, 33183. Miami Visit the web site davidensigniatennis@gmail.com +1 (305)833-3896 3058333896 David Ensignia Tennis Academy Cookie policy | Privacy policy | Terms of use | Rules of the club Copyright © 2024 Wansport.com ® All Rights Reserved Close...
Domain Name: WANSPORT.COM Registry Domain ID: 1589712031_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.ovh.com Registrar URL: http://www.ovh.com Updated Date: 2024-01-29T16:36:10Z Creation Date: 2010-03-22T15:43:17Z Registry Expiry Date: 2025-03-22T15:43:17Z Registrar: OVH sas Registrar IANA ID: 433 Registrar Abuse Contact Email: abuse@ovh.net Registrar Abuse Contact Phone: +33.972101007 Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: DNS200.ANYCAST.ME Name Server: NS200.ANYCAST.ME DNSSEC: unsigned >>> Last update of whois database: 2024-05-18T02:09:41Z <<<